PDB entry 1a30

View 1a30 on RCSB PDB site
Description: hiv-1 protease complexed with a tripeptide inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: ASPARTIC PROTEASE, HIV PROTEASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1998-01-27, released 1998-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
    Domains in SCOPe 2.07: d1a30a_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
    Domains in SCOPe 2.07: d1a30b_
  • Chain 'C':
    Compound: tripeptide glu-asp-leu
    Database cross-references and differences (RAF-indexed):
    • PDB 1A30 (0-2)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a30A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a30B (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'C':
    No sequence available.