PDB entry 1a2s

View 1a2s on RCSB PDB site
Description: the solution nmr structure of oxidized cytochrome c6 from the green alga monoraphidium braunii, minimized average structure
Class: electron transport
Keywords: cytochrome c6, photosystem I, electron transport, paramagnetic nmr, solution structure, heme protein
Deposited on 1998-01-10, released 1998-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c6
  Species: Monoraphidium braunii [TaxId:34112]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q09099 (0-88)
  Domains in SCOPe 2.07: d1a2sa_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a2sA (A:)
  eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
  mpawdgrldedeiagvaayvydqaagnkw