PDB entry 1a2s

View 1a2s on RCSB PDB site
Description: the solution nmr structure of oxidized cytochrome c6 from the green alga monoraphidium braunii, minimized average structure
Deposited on 1998-01-10, released 1998-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1a2s__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a2s_ (-)
    eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
    mpawdgrldedeiagvaayvydqaagnkw