PDB entry 1a2l

View 1a2l on RCSB PDB site
Description: reduced dsba at 2.7 angstroms resolution
Deposited on 1998-01-06, released 1998-07-08
The last revision prior to the SCOP 1.65 freeze date was dated 1998-07-08, with a file datestamp of 1998-07-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.233
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a2lA (A:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a2lA (A:)
    yedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhvn
    fmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgeey
    daawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadtv
    kylsek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a2lB (B:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a2lB (B:)
    yedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhvn
    fmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgeey
    daawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadtv
    kylsek