PDB entry 1a24

View 1a24 on RCSB PDB site
Description: solution nmr structure of reduced dsba from escherichia coli, family of 20 structures
Deposited on 1998-01-15, released 1998-09-16
The last revision prior to the SCOP 1.63 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a24_ (-)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk