PDB entry 1a23

View 1a23 on RCSB PDB site
Description: solution nmr structure of reduced dsba from escherichia coli, minimized average structure
Deposited on 1998-01-15, released 1998-09-16
The last revision prior to the SCOP 1.65 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a23_ (-)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk