PDB entry 1a1r

View 1a1r on RCSB PDB site
Description: hcv ns3 protease domain:ns4a peptide complex
Deposited on 1997-12-15, released 1998-06-17
The last revision prior to the SCOP 1.61 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1a1r.1
  • Chain 'B':
    Domains in SCOP 1.61: d1a1r.2
  • Chain 'C':
    Domains in SCOP 1.61: d1a1r.1
  • Chain 'D':
    Domains in SCOP 1.61: d1a1r.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a1rA (A:)
    vegevqivstatqtflatcingvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpap
    qgsrsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcptg
    havglfraavctrgvakavdfipvenlettmr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a1rB (B:)
    pitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcingvcwtvyhgagt
    rtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrhadvipvrrrgd
    srgsllsprpisylkgssggpllcptghavglfraavctrgvakavdfipvenlettmr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a1rC (C:)
    gsvvivgrivlsgkpa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a1rD (D:)
    kgsvvivgrivlsgkpaiipk