PDB entry 1a1q

View 1a1q on RCSB PDB site
Description: hepatitis c virus ns3 proteinase
Deposited on 1997-12-12, released 1998-03-25
The last revision prior to the SCOP 1.61 freeze date was dated 1998-03-25, with a file datestamp of 1998-03-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1a1qa_
  • Chain 'B':
    Domains in SCOP 1.61: d1a1qb_
  • Chain 'C':
    Domains in SCOP 1.61: d1a1qc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a1qA (A:)
    pitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgags
    ktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgd
    srgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmrs
    pvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a1qB (B:)
    pitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgags
    ktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgd
    srgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a1qB (B:)
    pitaysqgllgciitsltqvegevqvvstatqsflatcvngvcwtvyhgagsktlagpkg
    pitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgdsrgsllsp
    rpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a1qC (C:)
    pitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgags
    ktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgd
    srgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettm