PDB entry 1a1d

View 1a1d on RCSB PDB site
Description: yeast rna polymerase subunit rpb8, nmr, minimized average structure, alpha carbons only
Deposited on 1997-12-10, released 1999-03-02
The last revision prior to the SCOP 1.71 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1a1d__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a1d_ (-)
    msntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtia
    sslnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfgg
    llmrlegnyrnlnnlkqenayllirr