PDB entry 1a1c

View 1a1c on RCSB PDB site
Description: c-src (sh2 domain) complexed with ace-phosphotyr-glu-(n-me(-(ch2)3- cyclopentyl))
Deposited on 1997-12-10, released 1998-04-08
The last revision prior to the SCOP 1.61 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1a1ca_
  • Chain 'B':
    Domains in SCOP 1.61: d1a1cb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a1cA (A:)
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1a1cB (B:)
iqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhy
kirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp