PDB entry 1a14

View 1a14 on RCSB PDB site
Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 5 residue linker and influenza virus neuraminidase
Deposited on 1997-12-21, released 1998-05-13
The last revision prior to the SCOP 1.65 freeze date was dated 1998-05-13, with a file datestamp of 1998-05-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.65: d1a14h_
  • Chain 'L':
    Domains in SCOP 1.65: d1a14l_
  • Chain 'N':
    Domains in SCOP 1.65: d1a14n_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a14H (H:)
    qvqlqqsgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
    nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a14L (L:)
    dieltqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
    rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtaa
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a14N (N:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl