PDB entry 1a0r

View 1a0r on RCSB PDB site
Description: heterotrimeric complex of phosducin/transducin beta-gamma
Class: complex (transducer/transduction)
Keywords: phosducin, transducin, beta-gamma, signal transduction, regulation, phosphorylation, g proteins, thioredoxin, vision, meka, complex (transducer/transduction), post-translational modification, farnesyl, farnesylation
Deposited on 1997-12-05, released 1998-12-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.228
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: transducin (beta subunit)
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04901 (0-338)
      • conflict (69)
    Domains in SCOPe 2.06: d1a0rb_
  • Chain 'G':
    Compound: transducin (gamma subunit)
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1a0rg_
  • Chain 'P':
    Compound: phosducin
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1a0rp_
  • Heterogens: FAR, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0rB (B:)
    seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyam
    hwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnic
    siynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttft
    ghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnaf
    atgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalk
    adragvlaghdnrvsclgvtddgmavatgswdsflkiwn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a0rG (G:)
    pviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedk
    npfke
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1a0rP (P:)
    mekaksqsleedfegqashtgpkgvindwrkfklesedsdsvahskkeilrqmsspqsrd
    dkdskerfsrkmsvqeyelihkdkedenclrkyrrqcmqdmhqklsfgprygfvyelesg
    eqfletiekeqkittivvhiyedgikgcdalnssliclaaeypmvkfckikasntgagdr
    fssdvlptllvykggellsnfisvteqlaeefftgdvesflneygllpekemhvleqtnm
    eedme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0rP (P:)
    fegqashtgpkgvindwrkfklesefsrkmsvqeyelihkdkedenclrkyrrqcmqdmh
    qklsfgprygfvyelesgeqfletiekeqkittivvhiyedgikgcdalnssliclaaey
    pmvkfckikasntgagdrfssdvlptllvykggellsnfisvteqlaeefftgdvesfln
    eygllpek