PDB entry 1a0q

View 1a0q on RCSB PDB site
Description: 29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate
Class: catalytic antibody
Keywords: catalytic antibody, esterase
Deposited on 1997-12-05, released 1999-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 29g11 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC28908 (5-215)
      • conflict (7-8)
      • conflict (19)
      • conflict (30-31)
      • conflict (33)
      • conflict (41)
      • conflict (51)
      • conflict (53)
      • conflict (55-57)
      • conflict (71)
      • conflict (81-82)
      • conflict (94)
      • conflict (96)
      • conflict (100)
      • conflict (113-114)
    Domains in SCOPe 2.06: d1a0qh1, d1a0qh2
  • Chain 'L':
    Compound: 29g11 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAG43420 (2-211)
      • conflict (3)
      • conflict (21)
      • conflict (25)
      • conflict (29)
      • conflict (33)
      • conflict (42)
      • conflict (54)
      • conflict (62)
      • conflict (91)
      • conflict (139)
      • conflict (185)
    Domains in SCOPe 2.06: d1a0ql1, d1a0ql2
  • Heterogens: ZN, HEP, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1a0qH (H:)
    evqlqesdaelvkpgasvkisckasgytftdhvihwvkqkpeqglewigyispgngdiky
    nekfkgkatltadkssstaymqlnsltsedsavylckrgyygrsnvdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0qH (H:)
    vqlqesdaelvkpgasvkisckasgytftdhvihwvkqkpeqglewigyispgngdikyn
    ekfkgkatltadkssstaymqlnsltsedsavylckrgyyvdywgqgttltvssakttpp
    svyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpss
    twpsetvtcnvahpasstkvdkkie
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1a0qL (L:)
    dieltqspsslsaslggkvtitckasqdikkyigwyqhkpgkqprllihytstllpgips
    rfrgsgsgrdysfsisnlepediatyyclqyynlrtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfyskdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0qL (L:)
    ieltqspsslsaslggkvtitckasqdikkyigwyqhkpgkqprllihytstllpgipsr
    frgsgsgrdysfsisnlepediatyyclqyynlrtfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfyskdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrne