PDB entry 1a0i

View 1a0i on RCSB PDB site
Description: atp-dependent dna ligase from bacteriophage t7 complex with atp
Deposited on 1997-12-01, released 1998-03-25
The last revision prior to the SCOP 1.67 freeze date was dated 1998-03-25, with a file datestamp of 1998-03-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.222
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1a0i_ (-)
    vniktnpfkavsfvesaikkaldnagyliaeikydgvrgnicvdntansywlsrvsktip
    alehlngfdvrwkrllnddrcfykdgfmldgelmvkgvdfntgsgllrtkwtdtknqefh
    eelfvepirkkdkvpfklhtghlhiklyailplhivesgedcdvmtllmqehvknmlpll
    qeyfpeiewqaaesyevydmvelqqlyeqkraegheglivkdpmciykrgkksgwwkmkp
    eneadgiiqglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatls
    qwgffspygigdndactinpydgwacqisymeetpdgslrhpsfvmfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0i_ (-)
    vniktnpfkavsfvesaikkaldnagyliaeikydgvrgnicvdntansywlsrvsktip
    alehlngfdvrwkrllnddrcfykdgfmldgelmvkgvdfntgsgllrtkwtdtknqefh
    rkkdkvpfklhtghlhiklyailplhivesgedcdvmtllmqehvknmlpllqeyfpeie
    wqaaesyevydmvelqqlyeqkraegheglivkdpmciykrgkksgwwkmkpeneadgii
    qglvwgtkglanegkvigfevllesgrlvnatnisralmdeftetvkeatlsqwgffdac
    tinpydgwacqisymeetpdgslrhpsfvmfr