PDB entry 17gs

View 17gs on RCSB PDB site
Description:
Deposited on 1997-12-07, released 1998-12-30
The last revision prior to the SCOP 1.67 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d17gsa1, d17gsa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d17gsb1, d17gsb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >17gsA (A:)
    mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpafqdgd
    ltlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyv
    kalpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsay
    vgrlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >17gsB (B:)
    mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpafqdgd
    ltlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyv
    kalpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsay
    vgrlsarpklkaflaspeyvnlpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >17gsB (B:)
    pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpafqdgdlt
    lyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvka
    lpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayvg
    rlsarpklkaflaspeyvnlpingngkq