PDB entry 12e8

View 12e8 on RCSB PDB site
Description: 2e8 fab fragment
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1998-03-14, released 1998-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.221
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-kappa 2e8 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PIR S49220 (1-220)
      • conflict (2)
      • conflict (4-5)
      • conflict (10)
      • conflict (12)
      • conflict (31)
      • conflict (33)
      • conflict (42)
      • conflict (49)
      • conflict (53-54)
      • conflict (56-58)
      • conflict (60)
      • conflict (66)
      • conflict (69)
      • conflict (75)
      • conflict (96-97)
      • insertion (99-100)
      • conflict (102-103)
      • conflict (103)
      • conflict (103)
      • conflict (114-115)
      • conflict (119)
    Domains in SCOPe 2.07: d12e8h1, d12e8h2
  • Chain 'L':
    Compound: igg1-kappa 2e8 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAG12167 (0-213)
      • conflict (20)
      • conflict (31)
      • conflict (45-46)
      • conflict (52)
      • conflict (55)
      • conflict (77)
      • conflict (84)
      • conflict (91)
      • conflict (162)
    Domains in SCOPe 2.07: d12e8l1, d12e8l2
  • Chain 'M':
    Compound: igg1-kappa 2e8 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAG12167 (0-213)
      • conflict (20)
      • conflict (31)
      • conflict (45-46)
      • conflict (52)
      • conflict (55)
      • conflict (77)
      • conflict (84)
      • conflict (91)
      • conflict (162)
    Domains in SCOPe 2.07: d12e8m1, d12e8m2
  • Chain 'P':
    Compound: igg1-kappa 2e8 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PIR S49220 (1-220)
      • conflict (2)
      • conflict (4-5)
      • conflict (10)
      • conflict (12)
      • conflict (31)
      • conflict (33)
      • conflict (42)
      • conflict (49)
      • conflict (53-54)
      • conflict (56-58)
      • conflict (60)
      • conflict (66)
      • conflict (69)
      • conflict (75)
      • conflict (96-97)
      • insertion (99-100)
      • conflict (102-103)
      • conflict (103)
      • conflict (103)
      • conflict (114-115)
      • conflict (119)
    Domains in SCOPe 2.07: d12e8p1, d12e8p2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >12e8H (H:)
    evqlqqsgaevvrsgasvklsctasgfnikdyyihwvkqrpekglewigwidpeigdtey
    vpkfqgkatmtadtssntaylqlssltsedtavyycnaghdydrgrfpywgqgtlvtvsa
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >12e8L (L:)
    divmtqsqkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklmiysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsatdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >12e8M (M:)
    divmtqsqkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklmiysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsatdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >12e8P (P:)
    evqlqqsgaevvrsgasvklsctasgfnikdyyihwvkqrpekglewigwidpeigdtey
    vpkfqgkatmtadtssntaylqlssltsedtavyycnaghdydrgrfpywgqgtlvtvsa
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd