PDB entry 120l

View 120l on RCSB PDB site
Description: the energetic cost and the structural consequences of burying a hydroxyl group within the core of a protein determined from ala to ser and val to thr substitutions in t4 lysozyme
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1993-05-28, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t4 lysozyme
    Species: coliphage T4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • conflict (40)
      • conflict (53)
      • conflict (96)
    Domains in SCOP 1.75: d120la_
  • Heterogens: CL, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >120lA (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnsakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

    Sequence, based on observed residues (ATOM records): (download) 
    >120lA (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnsakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk