PDB entry 113l

View 113l on RCSB PDB site
Description: structural basis of alpha-helix propensity at two sites in t4 lysozyme
Deposited on 1992-12-17, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d113l__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >113l_ (-)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakreldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk