PDB entry 109m

View 109m on RCSB PDB site
Description: sperm whale myoglobin d122n ethyl isocyanide at ph 9.0
Class: oxygen transport
Keywords: ligand binding, oxygen storage, oxygen binding, heme, oxygen transport
Deposited on 1997-12-22, released 1998-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.148
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • engineered (122)
    Domains in SCOPe 2.06: d109ma_
  • Heterogens: SO4, HEM, ENC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >109mA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg