PDB entry 106m

View 106m on RCSB PDB site
Description: sperm whale myoglobin v68f ethyl isocyanide at ph 9.0
Deposited on 1997-12-21, released 1998-04-08
The last revision prior to the SCOP 1.57 freeze date was dated 1999-05-17, with a file datestamp of 1999-05-16.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.155
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d106m__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >106m_ (-)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtfltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg