PDB entry 0c3a

View 0c3a on RCSB PDB site
Description: complement protein
Deposited on 1994-01-31, released 1994-01-31
Made obsolete on 2007-09-27

The last revision prior to the SCOP 1.63 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
No data on structure quality are available

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d0c3a__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >0c3a_ (-)
    svqltekrmnkvgkypkelrkccedgmrqnpmrfscqrrtrfislgeackkvfldccnyi
    telrrqharashlglar