PDB entry 3cu7

View 3cu7 on RCSB PDB site
Description: Human Complement Component 5
Class: Immune System
Keywords: MG domain, complement, inflammation, anaphylatoxin, Cleavage on pair of basic residues, Complement alternate pathway, Complement pathway, Cytolysis, Glycoprotein, Immune response, Inflammatory response, Innate immunity, Membrane attack complex, Secreted, Immune System
Deposited on 2008-04-16, released 2008-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.238
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cu7A (A:)
    mgllgilcfliflgktwgqeqtyvisapkifrvgaseniviqvygyteafdatisiksyp
    dkkfsyssghvhlssenkfqnsailtiqpkqlpggqnpvsyvylevvskhfskskrmpit
    ydngflfihtdkpvytpdqsvkvrvyslnddlkpakretvltfidpegsevdmveeidhi
    giisfpdfkipsnprygmwtikakykedfsttgtayfevkeyvlphfsvsiepeynfigy
    knfknfeitikaryfynkvvteadvyitfgiredlkddqkemmqtamqntmlingiaqvt
    fdsetavkelsyysledlnnkylyiavtviestggfseeaeipgikyvlspyklnlvatp
    lflkpgipypikvqvkdsldqlvggvpvtlnaqtidvnqetsdldpsksvtrvddgvasf
    vlnlpsgvtvlefnvktdapdlpeenqaregyraiaysslsqsylyidwtdnhkallvge
    hlniivtpkspyidkithynylilskgkiihfgtrekfsdasyqsinipvtqnmvpssrl
    lvyyivtgeqtaelvsdsvwlnieekcgnqlqvhlspdadayspgqtvslnmatgmdswv
    alaavdsavygvqrgakkplervfqfleksdlgcgaggglnnanvfhlagltfltnanad
    dsqendepckeilrprrtlqkkieeiaakykhsvvkkccydgacvnndetceqraarisl
    gprcikafteccvvasqlranishkdmqlgrlhmktllpvskpeirsyfpeswlwevhlv
    prrkqlqfalpdslttweiqgigisntgicvadtvkakvfkdvflemnipysvvrgeqiq
    lkgtvynyrtsgmqfcvkmsavegictsespvidhqgtksskcvrqkvegssshlvtftv
    lpleiglhninfsletwfgkeilvktlrvvpegvkresysgvtldprgiygtisrrkefp
    yripldlvpkteikrilsvkgllvgeilsavlsqeginilthlpkgsaeaelmsvvpvfy
    vfhyletgnhwnifhsdpliekqklkkklkegmlsimsyrnadysysvwkggsastwlta
    falrvlgqvnkyveqnqnsicnsllwlvenyqldngsfkensqyqpiklqgtlpvearen
    slyltaftvigirkafdicplvkidtalikadnfllentlpaqstftlaisayalslgdk
    thpqfrsivsalkrealvkgnppiyrfwkdnlqhkdssvpntgtarmvettayalltsln
    lkdinyvnpvikwlseeqrygggfystqdtinaieglteysllvkqlrlsmdidvsykhk
    galhnykmtdknflgrpvevllnddlivstgfgsglatvhvttvvhktstseevcsfylk
    idtqdieashyrgygnsdykrivacasykpsreesssgsshavmdislptgisaneedlk
    alvegvdqlftdyqikdghvilqlnsipssdflcvrfrifelfevgflspatftvyeyhr
    pdkqctmfystsnikiqkvcegaackcveadcgqmqeeldltisaetrkqtackpeiaya
    ykvsitsitvenvfvkykatlldiyktgeavaekdseitfikkvtctnaelvkgrqylim
    gkealqikynfsfryiypldsltwieywprdttcsscqaflanldefaediflngc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cu7A (A:)
    eqtyvisapkifrvgaseniviqvygyteafdatisiksypdkkfsyssghvhlssenkf
    qnsailtiqpkqlpggqnpvsyvylevvskhfskskrmpitydngflfihtdkpvytpdq
    svkvrvyslnddlkpakretvltfidpegsevdmveeidhigiisfpdfkipsnprygmw
    tikakykedfsttgtayfevkeyvlphfsvsiepeynfigyknfknfeitikaryfynkv
    vteadvyitfgiredlkddqkemmqtamqntmlingiaqvtfdsetavkelsyysledln
    nkylyiavtviestggfseeaeipgikyvlspyklnlvatplflkpgipypikvqvkdsl
    dqlvggvpvtlnaqtidvnqetsdldpsksvtrvddgvasfvlnlpsgvtvlefnvktda
    pdlpeenqaregyraiaysslsqsylyidwtdnhkallvgehlniivtpkspyidkithy
    nylilskgkiihfgtrekfsdasyqsinipvtqnmvpssrllvyyivtgeqtaelvsdsv
    wlnieekcgnqlqvhlspdadayspgqtvslnmatgmdswvalaavdsavygvqrgakkp
    lervfqfleksdlgcgaggglnnanvfhlagltfltnanaddsqendepckeillqkkie
    eiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasqlranisl
    grlhmktllpvskpeirsyfpeswlwevhlvprrkqlqfalpdslttweiqgigisntgi
    cvadtvkakvfkdvflemnipysvvrgeqiqlkgtvynyrtsgmqfcvkmsavegictse
    spkcvrqkvegssshlvtftvlpleiglhninfsletwfgkeilvktlrvvpegvkresy
    sgvtldprgiygtisrrkefpyripldlvpkteikrilsvkgllvgeilsavlsqegini
    lthlpkgsaeaelmsvvpvfyvfhyletgnhwnifhsdpliekqklkkklkegmlsimsy
    rnadysysvwkggsastwltafalrvlgqvnkyveqnqnsicnsllwlvenyqldngsfk
    ensqyqpiklqgtlpvearenslyltaftvigirkafdicplvkidtalikadnfllent
    lpaqstftlaisayalslgdkthpqfrsivsalkrealvkgnppiyrfwkdnlqhkdssv
    pntgtarmvettayalltslnlkdinyvnpvikwlseeqrygggfystqdtinaieglte
    ysllvkqlrlsmdidvsykhkgalhnykmtdknflgrpvevllnddlivstgfgsglatv
    hvttvvhktstseevcsfylkidtqdiykrivacasykpsreesssgsshavmdislptg
    isaneedlkalvegvdqlftdyqikdghvilqlnsipssdflcvrfrifelfevgflspa
    tftvyeyhrpdkqctmfystsnikiqkvcegaackcveadcgqmqeeldltisaetrkqt
    ackpeiayaykvsitsitvenvfvkykatlldiyktgeavaekdseitfikkvtctnael
    vkgrqylimgkealqikynfsfryiypldsltwieywprdttcsscqaflanldefaedi
    flngc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cu7B (B:)
    mgllgilcfliflgktwgqeqtyvisapkifrvgaseniviqvygyteafdatisiksyp
    dkkfsyssghvhlssenkfqnsailtiqpkqlpggqnpvsyvylevvskhfskskrmpit
    ydngflfihtdkpvytpdqsvkvrvyslnddlkpakretvltfidpegsevdmveeidhi
    giisfpdfkipsnprygmwtikakykedfsttgtayfevkeyvlphfsvsiepeynfigy
    knfknfeitikaryfynkvvteadvyitfgiredlkddqkemmqtamqntmlingiaqvt
    fdsetavkelsyysledlnnkylyiavtviestggfseeaeipgikyvlspyklnlvatp
    lflkpgipypikvqvkdsldqlvggvpvtlnaqtidvnqetsdldpsksvtrvddgvasf
    vlnlpsgvtvlefnvktdapdlpeenqaregyraiaysslsqsylyidwtdnhkallvge
    hlniivtpkspyidkithynylilskgkiihfgtrekfsdasyqsinipvtqnmvpssrl
    lvyyivtgeqtaelvsdsvwlnieekcgnqlqvhlspdadayspgqtvslnmatgmdswv
    alaavdsavygvqrgakkplervfqfleksdlgcgaggglnnanvfhlagltfltnanad
    dsqendepckeilrprrtlqkkieeiaakykhsvvkkccydgacvnndetceqraarisl
    gprcikafteccvvasqlranishkdmqlgrlhmktllpvskpeirsyfpeswlwevhlv
    prrkqlqfalpdslttweiqgigisntgicvadtvkakvfkdvflemnipysvvrgeqiq
    lkgtvynyrtsgmqfcvkmsavegictsespvidhqgtksskcvrqkvegssshlvtftv
    lpleiglhninfsletwfgkeilvktlrvvpegvkresysgvtldprgiygtisrrkefp
    yripldlvpkteikrilsvkgllvgeilsavlsqeginilthlpkgsaeaelmsvvpvfy
    vfhyletgnhwnifhsdpliekqklkkklkegmlsimsyrnadysysvwkggsastwlta
    falrvlgqvnkyveqnqnsicnsllwlvenyqldngsfkensqyqpiklqgtlpvearen
    slyltaftvigirkafdicplvkidtalikadnfllentlpaqstftlaisayalslgdk
    thpqfrsivsalkrealvkgnppiyrfwkdnlqhkdssvpntgtarmvettayalltsln
    lkdinyvnpvikwlseeqrygggfystqdtinaieglteysllvkqlrlsmdidvsykhk
    galhnykmtdknflgrpvevllnddlivstgfgsglatvhvttvvhktstseevcsfylk
    idtqdieashyrgygnsdykrivacasykpsreesssgsshavmdislptgisaneedlk
    alvegvdqlftdyqikdghvilqlnsipssdflcvrfrifelfevgflspatftvyeyhr
    pdkqctmfystsnikiqkvcegaackcveadcgqmqeeldltisaetrkqtackpeiaya
    ykvsitsitvenvfvkykatlldiyktgeavaekdseitfikkvtctnaelvkgrqylim
    gkealqikynfsfryiypldsltwieywprdttcsscqaflanldefaediflngc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cu7B (B:)
    eqtyvisapkifrvgaseniviqvygyteafdatisiksypdkkfsyssghvhlssenkf
    qnsailtiqpkqlpggqnpvsyvylevvskhfskskrmpitydngflfihtdkpvytpdq
    svkvrvyslnddlkpakretvltfidpegsevdmveeidhigiisfpdfkipsnprygmw
    tikakykedfsttgtayfevkeyvlphfsvsiepeynfigyknfknfeitikaryfynkv
    vteadvyitfgiredlkddqkemmqtamqntmlingiaqvtfdsetavkelsyysledln
    nkylyiavtviestggfseeaeipgikyvlspyklnlvatplflkpgipypikvqvkdsl
    dqlvggvpvtlnaqtidvnqetsdldpsksvtrvddgvasfvlnlpsgvtvlefnvktda
    pdlpeenqaregyraiaysslsqsylyidwtdnhkallvgehlniivtpkspyidkithy
    nylilskgkiihfgtrekfsdasyqsinipvtqnmvpssrllvyyivtgeqtaelvsdsv
    wlnieekcgnqlqvhlspdadayspgqtvslnmatgmdswvalaavdsavygvqrgakkp
    lervfqfleksdlgcgaggglnnanvfhlagltfltnanaddsqendepckeillqkkie
    eiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasqlranisl
    grlhmktllpvskpeirsyfpeswlwevhlvprrkqlqfalpdslttweiqgigisntgi
    cvadtvkakvfkdvflemnipysvvrgeqiqlkgtvynyrtsgmqfcvkmsavegictse
    spkcvrqkvegssshlvtftvlpleiglhninfsletwfgkeilvktlrvvpegvkresy
    sgvtldprgiygtisrrkefpyripldlvpkteikrilsvkgllvgeilsavlsqegini
    lthlpkgsaeaelmsvvpvfyvfhyletgnhwnifhsdpliekqklkkklkegmlsimsy
    rnadysysvwkggsastwltafalrvlgqvnkyveqnqnsicnsllwlvenyqldngsfk
    ensqyqpiklqgtlpvearenslyltaftvigirkafdicplvkidtalikadnfllent
    lpaqstftlaisayalslgdkthpqfrsivsalkrealvkgnppiyrfwkdnlqhkdssv
    pntgtarmvettayalltslnlkdinyvnpvikwlseeqrygggfystqdtinaieglte
    ysllvkqlrlsmdidvsykhkgalhnykmtdknflgrpvevllnddlivstgfgsglatv
    hvttvvhktstseevcsfylkidtqdiykrivacasykpsreesssgsshavmdislptg
    isaneedlkalvegvdqlftdyqikdghvilqlnsipssdflcvrfrifelfevgflspa
    tftvyeyhrpdkqctmfystsnikiqkvcegaackcveadc