Lineage for d1oyvi_ (1oyv I:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894446Fold g.69: Plant proteinase inhibitors [100896] (1 superfamily)
    disulfide-rich small alpha+beta fold; topological similarity to the Ovomucoid domain III
  4. 894447Superfamily g.69.1: Plant proteinase inhibitors [100897] (1 family) (S)
  5. 894448Family g.69.1.1: Plant proteinase inhibitors [57486] (3 protein domains)
  6. 894459Protein Wound-induced proteinase inhibitor-II [90168] (1 species)
    two-domain inhibitor; consists of one continuous domain of canonical fold and one discontinuous, circularly-permutated domain
  7. 894460Species Tomato (Lycopersicon esculentum) [TaxId:4081] [90169] (2 PDB entries)
  8. 894469Domain d1oyvi_: 1oyv I: [87620]
    Other proteins in same PDB: d1oyva_, d1oyvb_
    complexed with ca

Details for d1oyvi_

PDB Entry: 1oyv (more details), 2.5 Å

PDB Description: crystal structure of tomato inhibitor-ii in a ternary complex with subtilisin carlsberg
PDB Compounds: (I:) Wound-induced proteinase inhibitor-II

SCOP Domain Sequences for d1oyvi_:

Sequence, based on SEQRES records: (download)

>d1oyvi_ g.69.1.1 (I:) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum) [TaxId: 4081]}
kactrecgnlgfgicprsegsplnpicinccsgykgcnyynsfgkficegesdpkrpnac
tfncdpniaysrcprsqgksliyptgcttcctgykgcyyfgkdgkfvcegesdepk

Sequence, based on observed residues (ATOM records): (download)

>d1oyvi_ g.69.1.1 (I:) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum) [TaxId: 4081]}
kactrecgnlgfgicprsegsplnpicinccsgykgcnyynsfgkficegesdpkrpnac
tfncdpniaysrcgcttcctgykgcyyfgkdgkfvcegesdepk

SCOP Domain Coordinates for d1oyvi_:

Click to download the PDB-style file with coordinates for d1oyvi_.
(The format of our PDB-style files is described here.)

Timeline for d1oyvi_: