Lineage for d2p8qa1 (2p8q A:1-485)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775278Family a.118.1.1: Armadillo repeat [48372] (6 protein domains)
  6. 775320Protein Importin beta [48378] (3 species)
  7. 775327Species Human (Homo sapiens) [TaxId:9606] [48379] (10 PDB entries)
  8. 775331Domain d2p8qa1: 2p8q A:1-485 [149314]
    automatically matched to d1m5ns_

Details for d2p8qa1

PDB Entry: 2p8q (more details), 2.35 Å

PDB Description: Crystal Structure of human Importin beta bound to the Snurportin1 IBB-domain
PDB Compounds: (A:) importin beta-1 subunit

SCOP Domain Sequences for d2p8qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8qa1 a.118.1.1 (A:1-485) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
ayeaa

SCOP Domain Coordinates for d2p8qa1:

Click to download the PDB-style file with coordinates for d2p8qa1.
(The format of our PDB-style files is described here.)

Timeline for d2p8qa1: