SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4akea1 (4ake A:1-121,A:157-214)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109210Protein Adenylate kinase [52554] (16 species)
  7. 2109234Species Escherichia coli [TaxId:562] [52560] (8 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 122-156
  8. 2109245Domain d4akea1: 4ake A:1-121,A:157-214 [31909]
    Other proteins in same PDB: d4akea2, d4akeb2

Details for d4akea1

PDB Entry: 4ake (more details), 2.2 Å

PDB Description: adenylate kinase
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d4akea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4akea1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

SCOPe Domain Coordinates for d4akea1:

Click to download the PDB-style file with coordinates for d4akea1.
(The format of our PDB-style files is described here.)

Timeline for d4akea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4akea2