Lineage for d4akea1 (4ake A:1-121,A:157-214)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313182Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 313183Protein Adenylate kinase [52554] (10 species)
  7. 313215Species Escherichia coli [TaxId:562] [52560] (6 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 122-156
  8. 313224Domain d4akea1: 4ake A:1-121,A:157-214 [31909]
    Other proteins in same PDB: d4akea2, d4akeb2

Details for d4akea1

PDB Entry: 4ake (more details), 2.2 Å

PDB Description: adenylate kinase

SCOP Domain Sequences for d4akea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4akea1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

SCOP Domain Coordinates for d4akea1:

Click to download the PDB-style file with coordinates for d4akea1.
(The format of our PDB-style files is described here.)

Timeline for d4akea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4akea2