| Class b: All beta proteins [48724] (165 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.5: TRAP-like [51219] (2 families) ![]() shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains |
| Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein) oligomeric ring consists of 11 single-domain subunits |
| Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [51223] (8 PDB entries) |
| Domain d1utvp_: 1utv P: [99986] |
PDB Entry: 1utv (more details), 1.9 Å
SCOP Domain Sequences for d1utvp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utvp_ b.82.5.1 (P:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus [TaxId: 1422]}
tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
trhgvieseg
Timeline for d1utvp_: