Lineage for d1utvb_ (1utv B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 810538Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 810539Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
    oligomeric ring consists of 11 single-domain subunits
  6. 810540Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 810541Species Bacillus stearothermophilus [TaxId:1422] [51223] (10 PDB entries)
  8. 810618Domain d1utvb_: 1utv B: [99972]

Details for d1utvb_

PDB Entry: 1utv (more details), 1.9 Å

PDB Description: The structure of the trp RNA-binding attenuation protein (TRAP) bound to a RNA molecule containing UAGAU repeats (part II)
PDB Compounds: (B:) transcription attenuation protein mtrb

SCOP Domain Sequences for d1utvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utvb_ b.82.5.1 (B:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus [TaxId: 1422]}
tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
trhgviesegk

SCOP Domain Coordinates for d1utvb_:

Click to download the PDB-style file with coordinates for d1utvb_.
(The format of our PDB-style files is described here.)

Timeline for d1utvb_: