|  | Class b: All beta proteins [48724] (144 folds) | 
|  | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology | 
|  | Superfamily b.82.5: TRAP-like [51219] (2 families)  shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains | 
|  | Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein) oligomeric ring consists of 11 single-domain subunits | 
|  | Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species) | 
|  | Species Bacillus stearothermophilus [TaxId:1422] [51223] (7 PDB entries) | 
|  | Domain d1utfv_: 1utf V: [99961] | 
PDB Entry: 1utf (more details), 1.9 Å
SCOP Domain Sequences for d1utfv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utfv_ b.82.5.1 (V:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus}
tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
trhgvieseg
Timeline for d1utfv_: