Lineage for d1utfr_ (1utf R:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1331659Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 1331660Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins)
    oligomeric ring consists of 11 single-domain subunits
    automatically mapped to Pfam PF02081
  6. 1331661Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 1331662Species Bacillus stearothermophilus [TaxId:1422] [51223] (11 PDB entries)
  8. 1331733Domain d1utfr_: 1utf R: [99957]
    complexed with trp

Details for d1utfr_

PDB Entry: 1utf (more details), 1.9 Å

PDB Description: The structure of the trp RNA-binding attenuation protein (TRAP) bound to a RNA molecule containing UAGAU repeats (part I)
PDB Compounds: (R:) transcription attenuation protein mtrb

SCOPe Domain Sequences for d1utfr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utfr_ b.82.5.1 (R:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus [TaxId: 1422]}
tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
trhgvieseg

SCOPe Domain Coordinates for d1utfr_:

Click to download the PDB-style file with coordinates for d1utfr_.
(The format of our PDB-style files is described here.)

Timeline for d1utfr_: