Lineage for d1utfg_ (1utf G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2426409Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 2426410Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins)
    oligomeric ring consists of 11 single-domain subunits
    automatically mapped to Pfam PF02081
  6. 2426411Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 2426412Species Bacillus stearothermophilus [TaxId:1422] [51223] (11 PDB entries)
  8. 2426491Domain d1utfg_: 1utf G: [99946]
    complexed with trp
    complexed with trp

Details for d1utfg_

PDB Entry: 1utf (more details), 1.9 Å

PDB Description: The structure of the trp RNA-binding attenuation protein (TRAP) bound to a RNA molecule containing UAGAU repeats (part I)
PDB Compounds: (G:) transcription attenuation protein mtrb

SCOPe Domain Sequences for d1utfg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utfg_ b.82.5.1 (G:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus [TaxId: 1422]}
tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
trhgvieseg

SCOPe Domain Coordinates for d1utfg_:

Click to download the PDB-style file with coordinates for d1utfg_.
(The format of our PDB-style files is described here.)

Timeline for d1utfg_: