Lineage for d1utcb2 (1utc B:3-330)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809391Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) (S)
  5. 2809392Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (2 proteins)
  6. 2809393Protein Clathrin heavy-chain terminal domain [50991] (1 species)
  7. 2809394Species Norway rat (Rattus norvegicus) [TaxId:10116] [50992] (5 PDB entries)
  8. 2809397Domain d1utcb2: 1utc B:3-330 [99917]
    Other proteins in same PDB: d1utca1, d1utcb1
    complexed with peptide tlpwdlwtt from amphiphysin

Details for d1utcb2

PDB Entry: 1utc (more details), 2.3 Å

PDB Description: clathrin terminal domain complexed with tlpwdlwtt
PDB Compounds: (B:) clathrin heavy chain

SCOPe Domain Sequences for d1utcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utcb2 b.69.6.1 (B:3-330) Clathrin heavy-chain terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
ifvtapheatagiigvnrkgqvlsvcve

SCOPe Domain Coordinates for d1utcb2:

Click to download the PDB-style file with coordinates for d1utcb2.
(The format of our PDB-style files is described here.)

Timeline for d1utcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1utcb1