Lineage for d1utca2 (1utc A:4-330)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) (S)
  5. Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (2 proteins)
  6. Protein Clathrin heavy-chain terminal domain [50991] (1 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50992] (5 PDB entries)
  8. Domain d1utca2: 1utc A:4-330 [99915]
    Other proteins in same PDB: d1utca1, d1utcb1
    complexed with peptide tlpwdlwtt from amphiphysin

Details for d1utca2

PDB Entry: 1utc (more details), 2.3 Å

PDB Description: clathrin terminal domain complexed with tlpwdlwtt
PDB Compounds: (A:) clathrin heavy chain

SCOPe Domain Sequences for d1utca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpir
rpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalvt
dnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamql
ysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqpf
pkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisgeti
fvtapheatagiigvnrkgqvlsvcve

SCOPe Domain Coordinates for d1utca2 are not available.

Timeline for d1utca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1utca1
View in 3D
Domains from other chains:
(mouse over for more information)
d1utcb1, d1utcb2