![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (18 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (17 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Cellulose 1,4-beta-cellobiosidase CbhA, precatalytic domain [101521] (1 species) |
![]() | Species Clostridium thermocellum [TaxId:1515] [101522] (2 PDB entries) |
![]() | Domain d1ut9a2: 1ut9 A:208-305 [99913] Other proteins in same PDB: d1ut9a1 |
PDB Entry: 1ut9 (more details), 2.1 Å
SCOP Domain Sequences for d1ut9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ut9a2 b.1.18.2 (A:208-305) Cellulose 1,4-beta-cellobiosidase CbhA, precatalytic domain {Clostridium thermocellum} ilpqpdvrvnqvgylpegkkvatvvcnstqpvkwqlknaagvvvlegytepkgldkdsqd yvhwldfsdfategigyyfelptvnsptnyshpfdirk
Timeline for d1ut9a2: