Lineage for d1ut9a1 (1ut9 A:306-816)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004088Protein Cellulose 1,4-beta-cellobiosidase CbhA [101363] (1 species)
  7. 2004089Species Clostridium thermocellum [TaxId:1515] [101364] (2 PDB entries)
  8. 2004090Domain d1ut9a1: 1ut9 A:306-816 [99912]
    Other proteins in same PDB: d1ut9a2

Details for d1ut9a1

PDB Entry: 1ut9 (more details), 2.1 Å

PDB Description: structural basis for the exocellulase activity of the cellobiohydrolase cbha from c. thermocellum
PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d1ut9a1:

Sequence, based on SEQRES records: (download)

>d1ut9a1 a.102.1.2 (A:306-816) Cellulose 1,4-beta-cellobiosidase CbhA {Clostridium thermocellum [TaxId: 1515]}
diytqmkydalaffyhkrsgipiempyaggeqwtrpaghigiepnkgdtnvptwpqddey
agipqknytkdvtggwydagdhgkyvvnggiavwtlmnmyerakirgldnwgpyrdggmn
ipeqnngypdildearweieffkkmqvtekedpsiagmvhhkihdfrwtalgmlphedpq
prylrpvstaatlnfaatlaqsarlwkdydptfaadclekaeiawqaalkhpdiyaeytp
gsggpgggpynddyvgdefywaacelyvttgkdeyknylmnsphylempakmgenggang
ednglwgcftwgttqglgtitlalvenglpatdiqkarnniakaadrwlenieeqgyrlp
ikqaederggypwgsnsfilnqmivmgyaydftgdskyldgmfdgisyllgrnamdqsyv
tgygerplqnphdrfwtpqtskrfpapppgiisggpnsrfedptinaavkkdtppqkcfi
dhtdswstneitvnwnapfawvtayldqytd

Sequence, based on observed residues (ATOM records): (download)

>d1ut9a1 a.102.1.2 (A:306-816) Cellulose 1,4-beta-cellobiosidase CbhA {Clostridium thermocellum [TaxId: 1515]}
diytqmkydalaffyhkrsgipiempyaggeqwtrpaghigiepnkgdtnvptwpqddey
agipqknytkdvtggwydagdhgkyvvnggiavwtlmnmyerakirgldnwgpyrdggmn
ipeqnngypdildearweieffkkmqvtekedpsiagmvhhkihdfrwtalgmlphedpq
prylrpvstaatlnfaatlaqsarlwkdydptfaadclekaeiawqaalkhpdiyaeytp
gsggpgggpynddyvgdefywaacelyvttgkdeyknylmnsphylempakmgangedng
lwgcftwgttqglgtitlalvenglpatdiqkarnniakaadrwlenieeqgyrlpikqa
ederggypwgsnsfilnqmivmgyaydftgdskyldgmfdgisyllgrnamdqsyvtgyg
erplqnphdrfwtpqtskrfpapppgiisggpnsrfedptinaavkkdtppqkcfidhtd
swstneitvnwnapfawvtayldqytd

SCOPe Domain Coordinates for d1ut9a1:

Click to download the PDB-style file with coordinates for d1ut9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ut9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ut9a2