SCOP 1.71: Domain d1ut8b2: 1ut8 B:20-185

Lineage for d1ut8b2 (1ut8 B:20-185)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (2 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein T5 5'-exonuclease [53050] (1 species)

7. Species Bacteriophage T5 [TaxId:10726] [53051] (4 PDB entries)

8. Domain d1ut8b2: 1ut8 B:20-185 [99911]
   Other proteins in same PDB: d1ut8a1, d1ut8b1
   complexed with zn

Details for d1ut8b2

PDB Entry: 1ut8, 2.75 Å

PDB Description: divalent metal ions (zinc) bound to t5 5'-exonuclease

SCOP Domain Sequences for d1ut8b2:

Sequence; same for both SEQRES and ATOM records:

>d1ut8b2 c.120.1.2 (B:20-185) T5 5'-exonuclease {Bacteriophage T5}
rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
ighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhn

Timeline for d1ut8b2:

• d1ut8b2 first appeared in SCOP 1.67
  
• d1ut8b2 appears in SCOP 1.69
  
• d1ut8b2 appears in SCOP 1.73
  
• d1ut8b2 appears in the current release, SCOPe 2.08