![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) ![]() |
![]() | Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
![]() | Protein T5 5'-exonuclease [47813] (1 species) |
![]() | Species Bacteriophage T5 [TaxId:10726] [47814] (6 PDB entries) |
![]() | Domain d1ut8b1: 1ut8 B:186-291 [99910] Other proteins in same PDB: d1ut8a2, d1ut8b2 complexed with zn |
PDB Entry: 1ut8 (more details), 2.75 Å
SCOPe Domain Sequences for d1ut8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ut8b1 a.60.7.1 (B:186-291) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq
Timeline for d1ut8b1: