Lineage for d1ut8a1 (1ut8 A:186-291)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001760Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 2001761Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 2001794Protein T5 5'-exonuclease [47813] (1 species)
  7. 2001795Species Bacteriophage T5 [TaxId:10726] [47814] (6 PDB entries)
  8. 2001804Domain d1ut8a1: 1ut8 A:186-291 [99908]
    Other proteins in same PDB: d1ut8a2, d1ut8b2
    complexed with zn

Details for d1ut8a1

PDB Entry: 1ut8 (more details), 2.75 Å

PDB Description: divalent metal ions (zinc) bound to t5 5'-exonuclease
PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d1ut8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ut8a1 a.60.7.1 (A:186-291) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq

SCOPe Domain Coordinates for d1ut8a1:

Click to download the PDB-style file with coordinates for d1ut8a1.
(The format of our PDB-style files is described here.)

Timeline for d1ut8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ut8a2