SCOP 1.67: Domain d1ut8a1: 1ut8 A:186-291

Lineage for d1ut8a1 (1ut8 A:186-291)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein T5 5'-exonuclease [47813] (1 species)

7. Species Bacteriophage T5 [TaxId:10726] [47814] (4 PDB entries)

8. Domain d1ut8a1: 1ut8 A:186-291 [99908]
   Other proteins in same PDB: d1ut8a2, d1ut8b2

Details for d1ut8a1

PDB Entry: 1ut8, 2.75 Å

PDB Description: divalent metal ions (zinc) bound to t5 5'-exonuclease

SCOP Domain Sequences for d1ut8a1:

Sequence; same for both SEQRES and ATOM records:

>d1ut8a1 a.60.7.1 (A:186-291) T5 5'-exonuclease {Bacteriophage T5}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq

Timeline for d1ut8a1:

• d1ut8a1 is new in SCOP 1.67
  
• d1ut8a1 appears in SCOP 1.69
  
• d1ut8a1 appears in the current release, SCOPe 2.08