Lineage for d1ut7b1 (1ut7 B:1-163)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.143: NAC domain [101940] (1 superfamily)
    core: twisted 7-stranded beta-sheet (half-barrel)
  4. Superfamily b.143.1: NAC domain [101941] (1 family) (S)
  5. Family b.143.1.1: NAC domain [101942] (2 proteins)
    Pfam PF02365, NAM; transcription factor domain
  6. Protein No apical meristem (NAM, ANAC) [101943] (1 species)
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101944] (2 PDB entries)
  8. Domain d1ut7b1: 1ut7 B:1-163 [99907]
    Other proteins in same PDB: d1ut7a2, d1ut7b2
    complexed with au

Details for d1ut7b1

PDB Entry: 1ut7 (more details), 1.9 Å

PDB Description: structure of the conserved domain of anac, a member of the nac family of transcription factors
PDB Compounds: (B:) no apical meristem protein

SCOPe Domain Sequences for d1ut7b1:

Sequence, based on SEQRES records: (download)

>d1ut7b1 b.143.1.1 (B:1-163) No apical meristem (NAM, ANAC) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mgiqetdpltqlslppgfrfyptdeelmvqylcrkaagydfslqliaeidlykfdpwvlp
nkalfgekewyffsprdrkypngsrpnrvagsgywkatgtdkiistegqrvgikkalvfy
igkapkgtktnwimheyrliepsrrngstklddwvlcriykkq

Sequence, based on observed residues (ATOM records): (download)

>d1ut7b1 b.143.1.1 (B:1-163) No apical meristem (NAM, ANAC) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mgiqetdpltqlslppgfrfyptdeelmvqylcrkaagydfslqliaeidlykfdpwvlp
nkalfgekewyffsprdpnrvagsgywkatgtdkiistegqrvgikkalvfyigkapkgt
ktnwimheyrliepsddwvlcriykkq

SCOPe Domain Coordinates for d1ut7b1 are not available.

Timeline for d1ut7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ut7b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ut7a1, d1ut7a2