Lineage for d1ut7a_ (1ut7 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2088919Fold b.143: NAC domain [101940] (1 superfamily)
    core: twisted 7-stranded beta-sheet (half-barrel)
  4. 2088920Superfamily b.143.1: NAC domain [101941] (1 family) (S)
  5. 2088921Family b.143.1.1: NAC domain [101942] (2 proteins)
    Pfam PF02365, NAM; transcription factor domain
  6. 2088922Protein No apical meristem (NAM, ANAC) [101943] (1 species)
  7. 2088923Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101944] (2 PDB entries)
  8. 2088924Domain d1ut7a_: 1ut7 A: [99906]
    complexed with au

Details for d1ut7a_

PDB Entry: 1ut7 (more details), 1.9 Å

PDB Description: structure of the conserved domain of anac, a member of the nac family of transcription factors
PDB Compounds: (A:) no apical meristem protein

SCOPe Domain Sequences for d1ut7a_:

Sequence, based on SEQRES records: (download)

>d1ut7a_ b.143.1.1 (A:) No apical meristem (NAM, ANAC) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gshmgiqetdpltqlslppgfrfyptdeelmvqylcrkaagydfslqliaeidlykfdpw
vlpnkalfgekewyffsprdrkypngsrpnrvagsgywkatgtdkiistegqrvgikkal
vfyigkapkgtktnwimheyrliepsrrngstklddwvlcriykkq

Sequence, based on observed residues (ATOM records): (download)

>d1ut7a_ b.143.1.1 (A:) No apical meristem (NAM, ANAC) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gshmgiqltqlslppgfrfyptdeelmvqylcrkaagydfslqliaeidlykfdpwvlpn
kalfgekewyffsprdrpnrvagsgywkatgtdkiistegqrvgikkalvfyigkapkgt
ktnwimheyrliepsddwvlcriykkq

SCOPe Domain Coordinates for d1ut7a_:

Click to download the PDB-style file with coordinates for d1ut7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ut7a_: