![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.120.1: PIN domain-like [88723] (3 families) ![]() |
![]() | Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
![]() | Protein T5 5'-exonuclease [53050] (1 species) |
![]() | Species Bacteriophage T5 [TaxId:10726] [53051] (4 PDB entries) |
![]() | Domain d1ut5b2: 1ut5 B:20-185 [99905] Other proteins in same PDB: d1ut5a1, d1ut5b1 complexed with mn |
PDB Entry: 1ut5 (more details), 2.75 Å
SCOPe Domain Sequences for d1ut5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ut5b2 c.120.1.2 (B:20-185) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl ighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhn
Timeline for d1ut5b2: