Lineage for d1ut5b1 (1ut5 B:186-291)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356779Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 357023Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 357024Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 357048Protein T5 5'-exonuclease [47813] (1 species)
  7. 357049Species Bacteriophage T5 [TaxId:10726] [47814] (4 PDB entries)
  8. 357057Domain d1ut5b1: 1ut5 B:186-291 [99904]
    Other proteins in same PDB: d1ut5a2, d1ut5b2
    complexed with mn

Details for d1ut5b1

PDB Entry: 1ut5 (more details), 2.75 Å

PDB Description: divalent metal ions (manganese) bound to t5 5'-exonuclease

SCOP Domain Sequences for d1ut5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ut5b1 a.60.7.1 (B:186-291) T5 5'-exonuclease {Bacteriophage T5}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq

SCOP Domain Coordinates for d1ut5b1:

Click to download the PDB-style file with coordinates for d1ut5b1.
(The format of our PDB-style files is described here.)

Timeline for d1ut5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ut5b2