Lineage for d1ut3a_ (1ut3 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032898Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 3032899Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 3032900Family g.9.1.1: Defensin [57393] (11 proteins)
  6. 3032914Protein Beta-defensin, BD [63384] (7 species)
  7. 3032953Species King penguin (Aptenodytes patagonicus), spheniscin-2 [TaxId:9234] [103570] (1 PDB entry)
  8. 3032954Domain d1ut3a_: 1ut3 A: [99899]

Details for d1ut3a_

PDB Entry: 1ut3 (more details)

PDB Description: solution structure of spheniscin-2, a beta-defensin from penguin stomach preserving food
PDB Compounds: (A:) spheniscin-2

SCOPe Domain Sequences for d1ut3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ut3a_ g.9.1.1 (A:) Beta-defensin, BD {King penguin (Aptenodytes patagonicus), spheniscin-2 [TaxId: 9234]}
sfglcrlrrgfcargrcrfpsipigrcsrfvqccrrvw

SCOPe Domain Coordinates for d1ut3a_:

Click to download the PDB-style file with coordinates for d1ut3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ut3a_: