Lineage for d1usxc_ (1usx C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 468803Fold b.68: 6-bladed beta-propeller [50938] (10 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 468804Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 468805Family b.68.1.1: Sialidases (neuraminidases) [50940] (8 proteins)
  6. 468902Protein Paramyxovirus hemagglutinin-neuraminidase head domain [63823] (1 species)
  7. 468903Species Newcastle disease virus [TaxId:11176] [63824] (5 PDB entries)
  8. 468914Domain d1usxc_: 1usx C: [99898]

Details for d1usxc_

PDB Entry: 1usx (more details), 2.7 Å

PDB Description: crystal structure of the newcastle disease virus hemagglutinin- neuraminidase complexed with thiosialoside

SCOP Domain Sequences for d1usxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usxc_ b.68.1.1 (C:) Paramyxovirus hemagglutinin-neuraminidase head domain {Newcastle disease virus}
gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
siaeisntlfgefrivpllveilkndg

SCOP Domain Coordinates for d1usxc_:

Click to download the PDB-style file with coordinates for d1usxc_.
(The format of our PDB-style files is described here.)

Timeline for d1usxc_: