SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1usxc_ (1usx C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065191Protein Paramyxovirus hemagglutinin-neuraminidase head domain [63823] (1 species)
  7. 2065192Species Newcastle disease virus [TaxId:11176] [63824] (5 PDB entries)
  8. 2065203Domain d1usxc_: 1usx C: [99898]
    complexed with dan, sia, wia

Details for d1usxc_

PDB Entry: 1usx (more details), 2.7 Å

PDB Description: Crystal structure of the Newcastle disease virus hemagglutinin-neuraminidase complexed with thiosialoside
PDB Compounds: (C:) hemagglutinin-neuraminidase glycoprotein

SCOPe Domain Sequences for d1usxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usxc_ b.68.1.1 (C:) Paramyxovirus hemagglutinin-neuraminidase head domain {Newcastle disease virus [TaxId: 11176]}
gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
siaeisntlfgefrivpllveilkndg

SCOPe Domain Coordinates for d1usxc_:

Click to download the PDB-style file with coordinates for d1usxc_.
(The format of our PDB-style files is described here.)

Timeline for d1usxc_: