![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.1: Sialidases [50939] (3 families) ![]() |
![]() | Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
![]() | Protein Paramyxovirus hemagglutinin-neuraminidase head domain [63823] (1 species) |
![]() | Species Newcastle disease virus [TaxId:11176] [63824] (5 PDB entries) |
![]() | Domain d1usxc_: 1usx C: [99898] complexed with dan |
PDB Entry: 1usx (more details), 2.7 Å
SCOPe Domain Sequences for d1usxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1usxc_ b.68.1.1 (C:) Paramyxovirus hemagglutinin-neuraminidase head domain {Newcastle disease virus [TaxId: 11176]} gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl siaeisntlfgefrivpllveilkndg
Timeline for d1usxc_: