Lineage for d1usvh_ (1usv H:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507350Fold d.83: Aha1/BPI domain-like [55393] (2 superfamilies)
    core: [beta]-alpha-beta(5)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, meander
  4. 507359Superfamily d.83.2: Activator of Hsp90 ATPase, Aha1 [103111] (1 family) (S)
    consists of a single domain of this fold
  5. 507360Family d.83.2.1: Activator of Hsp90 ATPase, Aha1 [103112] (1 protein)
  6. 507361Protein Activator of Hsp90 ATPase, Aha1 [103113] (1 species)
  7. 507362Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103114] (2 PDB entries)
  8. 507367Domain d1usvh_: 1usv H: [99894]
    Other proteins in same PDB: d1usva_, d1usvc_, d1usve_, d1usvg_
    complexed with a Hsp90 domain

Details for d1usvh_

PDB Entry: 1usv (more details), 2.7 Å

PDB Description: the structure of the complex between aha1 and hsp90

SCOP Domain Sequences for d1usvh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usvh_ d.83.2.1 (H:) Activator of Hsp90 ATPase, Aha1 {Baker's yeast (Saccharomyces cerevisiae)}
wvdkncigwakeyfkqklvgveagsvkdkkyakiksvssiegdcevnqrkgkvislfdlk
itvlieghvdskdgsalpfegsinvpevafdseassyqfdisifketselseakplirse
llpklrqifqqfgkdllathg

SCOP Domain Coordinates for d1usvh_:

Click to download the PDB-style file with coordinates for d1usvh_.
(The format of our PDB-style files is described here.)

Timeline for d1usvh_: