Lineage for d1usvf_ (1usv F:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728496Fold d.83: Aha1/BPI domain-like [55393] (2 superfamilies)
    core: [beta]-alpha-beta(5)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, meander
  4. 728505Superfamily d.83.2: Activator of Hsp90 ATPase, Aha1 [103111] (1 family) (S)
    consists of a single domain of this fold
  5. 728506Family d.83.2.1: Activator of Hsp90 ATPase, Aha1 [103112] (1 protein)
  6. 728507Protein Activator of Hsp90 ATPase, Aha1 [103113] (1 species)
  7. 728508Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103114] (2 PDB entries)
  8. 728512Domain d1usvf_: 1usv F: [99892]
    Other proteins in same PDB: d1usva_, d1usvc_, d1usve_, d1usvg_

Details for d1usvf_

PDB Entry: 1usv (more details), 2.7 Å

PDB Description: the structure of the complex between aha1 and hsp90
PDB Compounds: (F:) aha1

SCOP Domain Sequences for d1usvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usvf_ d.83.2.1 (F:) Activator of Hsp90 ATPase, Aha1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
whwvdkncigwakeyfkqklvgveagsvkdkkyakiksvssiegdcevnqrkgkvislfd
lkitvlieghvdskdgsalpfegsinvpevafdseassyqfdisifketselseakplir
sellpklrqifqqfgkdllathgndi

SCOP Domain Coordinates for d1usvf_:

Click to download the PDB-style file with coordinates for d1usvf_.
(The format of our PDB-style files is described here.)

Timeline for d1usvf_: