Lineage for d1usvc_ (1usv C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2157938Family d.14.1.8: Hsp90 middle domain [102755] (2 protein domains)
    related to the DNA gyrase/MutL family; contains extra C-terminal alpha/beta subdomain
    automatically mapped to Pfam PF00183
  6. 2157939Protein Heat shock protein hsp82 [102756] (1 species)
  7. 2157940Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102757] (3 PDB entries)
  8. 2157945Domain d1usvc_: 1usv C: [99889]
    Other proteins in same PDB: d1usvb_, d1usvd_, d1usvf_, d1usvh_
    complexed with Aha1

Details for d1usvc_

PDB Entry: 1usv (more details), 2.7 Å

PDB Description: the structure of the complex between aha1 and hsp90
PDB Compounds: (C:) heat shock protein hsp82

SCOPe Domain Sequences for d1usvc_:

Sequence, based on SEQRES records: (download)

>d1usvc_ d.14.1.8 (C:) Heat shock protein hsp82 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ktkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdl
feskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimkv
irknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksv
deltsltdyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaft
qlkefegktlvditkd

Sequence, based on observed residues (ATOM records): (download)

>d1usvc_ d.14.1.8 (C:) Heat shock protein hsp82 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ktkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdk
knniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlmlqqnkimkvirknivkkl
ieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdeltsltdy
vtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftqlkefegkt
lvditkd

SCOPe Domain Coordinates for d1usvc_:

Click to download the PDB-style file with coordinates for d1usvc_.
(The format of our PDB-style files is described here.)

Timeline for d1usvc_: