SCOPe 2.07: Domain d1usub_: 1usu B:

Lineage for d1usub_ (1usu B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.83: Aha1/BPI domain-like [55393] (2 superfamilies)
   core: [beta]-alpha-beta(5)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, meander

4. Superfamily d.83.2: Activator of Hsp90 ATPase, Aha1 [103111] (1 family)
   consists of a single domain of this fold
   automatically mapped to Pfam PF09229

5. Family d.83.2.1: Activator of Hsp90 ATPase, Aha1 [103112] (1 protein)

6. Protein Activator of Hsp90 ATPase, Aha1 [103113] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103114] (2 PDB entries)

8. Domain d1usub_: 1usu B: [99886]
   Other proteins in same PDB: d1usua_
   complexed with a Hsp90 domain
   complexed with gol

Details for d1usub_

PDB Entry: 1usu, 2.15 Å

PDB Description: the structure of the complex between aha1 and hsp90

PDB Compounds: (B:) aha1

SCOPe Domain Sequences for d1usub_:

Sequence, based on SEQRES records:

>d1usub_ d.83.2.1 (B:) Activator of Hsp90 ATPase, Aha1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vdkncigwakeyfkqkivgveagsvkdkkyakiksvssiegdcevnqrkgkvislfdlki
tvlieghvdskdgsalpfegsinvpevafdseassyqfdisifketselseakplirsel
lpklrqifqqfgkdllathgnd

Sequence, based on observed residues (ATOM records):

>d1usub_ d.83.2.1 (B:) Activator of Hsp90 ATPase, Aha1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vdkncigwakeyfkqkivgveakkyakiksvssiegdcevnqrgkvislfdlkitvlieg
hvdsalpfegsinvpevafdseassyqfdisifketselseakplirsellpklrqifqq
fgkdllathgnd

Timeline for d1usub_:

• d1usub_ first appeared in SCOP 1.67
  
• d1usub_ appears in SCOPe 2.06
  
• d1usub_ appears in the current release, SCOPe 2.08